PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID orange1.1g025894m
Common NameCISIN_1g025894mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family SRS
Protein Properties Length: 247aa    MW: 27309.2 Da    PI: 6.9762
Description SRS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
orange1.1g025894mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF70281.71.9e-2587142661
             DUF702   6 asCqdCGnqakkdCaheRCRtCCksrgfdCathvkstWvpaakrrerqqqlaaass 61 
                         +C+dCGn+ak++C+++RCRtCCk+r fdC+thv+stWvpaakrr++++  +  ss
  orange1.1g025894m  87 RACRDCGNRAKRECSFRRCRTCCKTRRFDCTTHVRSTWVPAAKRRQKKKLITGGSS 142
                        58********************************************9887766554 PP

2DUF70270.17e-2213721480154
             DUF702  80 skkqsalsstklssaeskkeletsslPeevsseavfrcvrvssvddgee...elaYqtavsigGhvfkGiLydqGlee 154
                        ++  s++s +  ++a+ + e+ ++slP +v+++avfrc++v++v+dg++   e++Y ++v+i+GhvfkG+Lyd G++e
  orange1.1g025894m 137 ITGGSSSSLSFSTTASCQDESFKKSLPGKVQAPAVFRCIKVTAVSDGDDnkaEVGYVATVNISGHVFKGFLYDLGIDE 214
                        3333333333333444455566677*******************88654222799********************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF051422.1E-2287137IPR007818Protein of unknown function DUF702
TIGRFAMsTIGR016235.4E-2389130IPR006510Zinc finger, lateral root primordium type 1
PfamPF051421.1E-18149213IPR007818Protein of unknown function DUF702
TIGRFAMsTIGR016241.8E-23162212IPR006511Lateral Root Primordium type 1, C-terminal
Sequence ? help Back to Top
Protein Sequence    Length: 247 aa     Download sequence    Send to blast
MDTTNRSGPL ISMLNLHDII FAAPPPQPPR ISSDLHHQDD DDDDNDRNTS NLHKIGFWGL  60
KKWQEESHTD VEDDSDDHDG DHSGLMRACR DCGNRAKREC SFRRCRTCCK TRRFDCTTHV  120
RSTWVPAAKR RQKKKLITGG SSSSLSFSTT ASCQDESFKK SLPGKVQAPA VFRCIKVTAV  180
SDGDDNKAEV GYVATVNISG HVFKGFLYDL GIDEKKLFPW DSSGRENKES SPPNVDSSNA  240
DATSGN*
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006494070.11e-139PREDICTED: protein SHI RELATED SEQUENCE 6
RefseqXP_015381404.11e-139PREDICTED: protein SHI RELATED SEQUENCE 6
TrEMBLA0A067EUM30.0A0A067EUM3_CITSI; Uncharacterized protein
STRINGPOPTR_0001s06500.15e-66(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM119592332
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G54430.19e-32SHI-related sequence 6